PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0516s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 247aa    MW: 26523.4 Da    PI: 7.6184
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0516s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.71.2e-23205245242
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-S CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversa 42 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++
  Kalax.0516s0001.1.p 205 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERNH 245
                          6**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-20197245IPR003657WRKY domain
PROSITE profilePS5081119.118199247IPR003657WRKY domain
SuperFamilySSF1182904.58E-19202246IPR003657WRKY domain
SMARTSM007741.7E-17204247IPR003657WRKY domain
PfamPF031069.5E-18206246IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MNLTNPHSAS DHLGRSGPHE PRFVPSHTTI PSPPAATEAA DTVVATVSSI PNVSRYKLMS  60
PAKLPISRSM PHTAPPGLSP SSQLDSPVQF CNIKVEPSPT TGTLHKPQPM LGGVGYAAAA  120
STSYANNSAC VGKISDNSEF GTQSQSNFAT GSSLLPSQAF PVTESQQYEL QSQHIEGEKA  180
IQYATASPPD QNEVRLSAVS DNSSTDGYNW RKYGQKHVKG CEFPRSYYKC THPNCEVKKL  240
LERNHDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298853.13e-47WRKY-like drought-induced family protein
SwissprotQ93WV01e-43WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLB9GJX13e-47B9GJX1_POPTR; WRKY-like drought-induced family protein
STRINGPOPTR_0001s37260.19e-47(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.15e-24WRKY family protein